PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla017511
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family FAR1
Protein Properties Length: 161aa    MW: 18212.8 Da    PI: 6.7563
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla017511genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR186.15.2e-2762150290
       FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                fY++YA+++GF +r+ + ++s+++g+i  r++ C+keg+  + + k    r++r++tr gCka+++vk +k+gkw++tk+++eHnH+l+
  Cla017511  62 FYDKYARQLGFVMRVMSCRRSEKDGRILARRLGCNKEGYCVSIRGKFGAVRKPRPSTREGCKAMIHVKYDKSGKWVITKFVKEHNHPLV 150
                9**************************************999999989***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031017.7E-2562150IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MDLRDNSERC LLTVDADEGE EGIEGGSFES PAGTELIECD GDIILEPYEG MEFESEDAAK  60
IFYDKYARQL GFVMRVMSCR RSEKDGRILA RRLGCNKEGY CVSIRGKFGA VRKPRPSTRE  120
GCKAMIHVKY DKSGKWVITK FVKEHNHPLV VAPREARQTM A
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011652117.11e-112PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_004136586.21e-112PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
SwissprotQ9SZL83e-27FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A0A0LBE01e-103A0A0A0LBE0_CUCSA; Uncharacterized protein
STRINGGLYMA06G48170.32e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96531104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.16e-77FAR1 family protein